PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021901-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 360aa    MW: 40063.1 Da    PI: 6.5075
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021901-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l+ ++kq G g+W++ ++  g++R++k+c++rw +yl
    NNU_021901-RA 14 KGPWMPEEDEKLIAYIKQNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding506.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k+ w+++l
    NNU_021901-RA  67 RGKFSQEEEKVIINLHSALGNK-WSAIASHLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23664IPR009057Homeodomain-like
PROSITE profilePS5129416.717961IPR017930Myb domain
SuperFamilySSF466899.17E-3011108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002495.7E-151461IPR001005SANT/Myb domain
CDDcd001673.07E-101661No hitNo description
PROSITE profilePS5129425.07462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-2765116IPR009057Homeodomain-like
SMARTSM007174.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1467112IPR001005SANT/Myb domain
CDDcd001671.07E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRSSCYDES GLKKGPWMPE EDEKLIAYIK QNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LKPDIKRGKF SQEEEKVIIN LHSALGNKWS AIASHLPGRT DNEIKNLWNT HLKKKLLNSG  120
IDPVTHRPRT DHHPDLFANL SQLFAVANLN SMMMKPLDNA LRLQEEVAQL ARNQLLQQLL  180
QATESSVPQN LAADSLSANA PILGFNHAEY LQPNNNHLEG LINNPPEGFQ SHPQGYHQSI  240
HPQELPSNPQ VVPNNLPCPG LYLPSNLANL GIQQPSNHSQ ILDNSVYFGG LSSPLINSEH  300
NMGDNNLINS YIDPAALDTI PPLVSASIEM EKKNMPINSS ILIDTWGEIN LQDDHHEASD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240893.10.0PREDICTED: myb-related protein 315-like
RefseqXP_010240894.10.0PREDICTED: myb-related protein 315-like
RefseqXP_010240895.10.0PREDICTED: myb-related protein 315-like
TrEMBLF6HEE41e-95F6HEE4_VITVI; Putative uncharacterized protein
STRINGVIT_16s0039g01710.t013e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-82myb domain protein 93